(data stored in ACNUC29543 zone)

EMBL: CT978603.PE529

CT978603.PE529       Location/Qualifiers
FT   CDS             470918..471406
FT                   /transl_table=11
FT                   /gene="SynRCC307_0529"
FT                   /locus_tag="SynRCC307_0529"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27432"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC3"
FT                   /protein_id="CAK27432.1"
FT                   /translation="MNQRRFFLKDLNCLAPMIKAGAGLLACSVGLLTSTPAQATSLHPC
FT                   GSIRIANTTFCFLDANGDGRYQEGEEEFCLDGWLTRGGLRCRGEGVKATPGSQASVITI
FT                   RVLTSWDESCPGSMSVDQINHHLRNGYRIVGTKTQTEMISTTGQPIACSYTTYSLQQR"
     MNQRRFFLKD LNCLAPMIKA GAGLLACSVG LLTSTPAQAT SLHPCGSIRI ANTTFCFLDA        60
     NGDGRYQEGE EEFCLDGWLT RGGLRCRGEG VKATPGSQAS VITIRVLTSW DESCPGSMSV       120
     DQINHHLRNG YRIVGTKTQT EMISTTGQPI ACSYTTYSLQ QR                          162
//

If you have problems or comments...

PBIL Back to PBIL home page