(data stored in ACNUC29543 zone)

EMBL: CT978603.PE532

CT978603.PE532       Location/Qualifiers
FT   CDS             472316..472570
FT                   /transl_table=11
FT                   /gene="SynRCC307_0532"
FT                   /locus_tag="SynRCC307_0532"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27435"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC6"
FT                   /protein_id="CAK27435.1"
FT                   /translation="MGGNSAGLASSCVGSTTRIVRDSDEVSAGVLCSGGGSGCVLVGGS
FT                   VSCFGSGRMSVGGSGSWFGSGAAKEGLTPVAPGHEPFSR"
     MGGNSAGLAS SCVGSTTRIV RDSDEVSAGV LCSGGGSGCV LVGGSVSCFG SGRMSVGGSG        60
     SWFGSGAAKE GLTPVAPGHE PFSR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page