(data stored in ACNUC29543 zone)

EMBL: CT978603.PE539

CT978603.PE539       Location/Qualifiers
FT   CDS             476582..477352
FT                   /transl_table=11
FT                   /gene="SynRCC307_0539"
FT                   /locus_tag="SynRCC307_0539"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27442"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD3"
FT                   /protein_id="CAK27442.1"
FT                   /translation="MAPARLSDSQKQELVSQFKAGVTAAALAEAFGCSPNTVSRTVKAL
FT                   LSPEEYEGLKQKRSGRGTAAVAVKEDEPKADEPETETAPEAPSPEAELEADEPLEGSSS
FT                   LALDDADDFGADDSDEELDELSDDDSVAETFVAIAPLPGLGVIDGGAPCVSKPLVDGSL
FT                   PSTVYLLVDRDVELKGTPVKDFSELGAVAATEMEHKAIALFSNPRQAKRQCGRSQRVIK
FT                   VPDSGVFGRTAPFILAQGISRIVLEGSLYAIPGA"
     MAPARLSDSQ KQELVSQFKA GVTAAALAEA FGCSPNTVSR TVKALLSPEE YEGLKQKRSG        60
     RGTAAVAVKE DEPKADEPET ETAPEAPSPE AELEADEPLE GSSSLALDDA DDFGADDSDE       120
     ELDELSDDDS VAETFVAIAP LPGLGVIDGG APCVSKPLVD GSLPSTVYLL VDRDVELKGT       180
     PVKDFSELGA VAATEMEHKA IALFSNPRQA KRQCGRSQRV IKVPDSGVFG RTAPFILAQG       240
     ISRIVLEGSL YAIPGA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page