(data stored in ACNUC29543 zone)

EMBL: CT978603.PE540

CT978603.PE540       Location/Qualifiers
FT   CDS             complement(477354..477569)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0540"
FT                   /locus_tag="SynRCC307_0540"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27443"
FT                   /db_xref="GOA:A5GRD4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD4"
FT                   /protein_id="CAK27443.1"
FT                   /translation="MLLRLRLLTGTMVSSLLLLVMLCLGSQNLNQREPLQLGFGQSAPL
FT                   PTGFVVGIALVCGVFSGGSVAALLRR"
     MLLRLRLLTG TMVSSLLLLV MLCLGSQNLN QREPLQLGFG QSAPLPTGFV VGIALVCGVF        60
     SGGSVAALLR R                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page