(data stored in ACNUC29543 zone)

EMBL: CT978603.PE548

CT978603.PE548       Location/Qualifiers
FT   CDS             complement(484928..485194)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0548"
FT                   /locus_tag="SynRCC307_0548"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27451"
FT                   /db_xref="GOA:A5GRE2"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE2"
FT                   /protein_id="CAK27451.1"
FT                   /translation="MTTDTAAATNDPQALTLENVERTLDELRPFLMADGGNVEVVEIDG
FT                   PIVKVRLQGACGSCPSSTMTLKMGIERKLREAIPEVSEVVQVL"
     MTTDTAAATN DPQALTLENV ERTLDELRPF LMADGGNVEV VEIDGPIVKV RLQGACGSCP        60
     SSTMTLKMGI ERKLREAIPE VSEVVQVL                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page