(data stored in ACNUC29543 zone)

EMBL: CT978603.PE553

CT978603.PE553       Location/Qualifiers
FT   CDS             491496..491693
FT                   /transl_table=11
FT                   /gene="SynRCC307_0553"
FT                   /locus_tag="SynRCC307_0553"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27456"
FT                   /db_xref="GOA:A5GRE7"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE7"
FT                   /protein_id="CAK27456.1"
FT                   /translation="MMWSKPTRQQGFVLPSVLLLGLVIITSGLALQAMALQGMLSQQRE
FT                   LKRDQKADAEFSAVMRQALD"
     MMWSKPTRQQ GFVLPSVLLL GLVIITSGLA LQAMALQGML SQQRELKRDQ KADAEFSAVM        60
     RQALD                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page