(data stored in ACNUC29543 zone)

EMBL: CT978603.PE554

CT978603.PE554       Location/Qualifiers
FT   CDS             491699..492094
FT                   /transl_table=11
FT                   /gene="SynRCC307_0554"
FT                   /locus_tag="SynRCC307_0554"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27457"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE8"
FT                   /protein_id="CAK27457.1"
FT                   /translation="MLVSAVLLGIFSSLGLQLSGSIGRAAQQQQQSADQQHWLALQLQR
FT                   DAGLLIRQGALLAVDCSNEKQREQGLLQLQALLEQVGSIEPAETFSTQRQLQVADGLLQ
FT                   LQVSIGELQRQREFSLQGLGACIDELG"
     MLVSAVLLGI FSSLGLQLSG SIGRAAQQQQ QSADQQHWLA LQLQRDAGLL IRQGALLAVD        60
     CSNEKQREQG LLQLQALLEQ VGSIEPAETF STQRQLQVAD GLLQLQVSIG ELQRQREFSL       120
     QGLGACIDEL G                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page