(data stored in ACNUC29543 zone)

EMBL: CT978603.PE555

CT978603.PE555       Location/Qualifiers
FT   CDS             492081..492554
FT                   /transl_table=11
FT                   /gene="SynRCC307_0555"
FT                   /locus_tag="SynRCC307_0555"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27458"
FT                   /db_xref="GOA:A5GRE9"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE9"
FT                   /protein_id="CAK27458.1"
FT                   /translation="MSLVELLTAVAIVGILAGTSINASRRPLAHQQLLAAARQLELGIE
FT                   QARDQAMDQQAPCALALGEAGWIAPQDGSLPACSDAVSPLLAGDRANGLRLNHNITALQ
FT                   FTANGLVLGGGTVRLAVDGLDQERCVVISLPLGITRRGLWENSQCVPPASAES"
     MSLVELLTAV AIVGILAGTS INASRRPLAH QQLLAAARQL ELGIEQARDQ AMDQQAPCAL        60
     ALGEAGWIAP QDGSLPACSD AVSPLLAGDR ANGLRLNHNI TALQFTANGL VLGGGTVRLA       120
     VDGLDQERCV VISLPLGITR RGLWENSQCV PPASAES                                157
//

If you have problems or comments...

PBIL Back to PBIL home page