(data stored in ACNUC29543 zone)

EMBL: CT978603.PE556

CT978603.PE556       Location/Qualifiers
FT   CDS             492526..492804
FT                   /transl_table=11
FT                   /gene="SynRCC307_0556"
FT                   /locus_tag="SynRCC307_0556"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27459"
FT                   /db_xref="GOA:A5GRF0"
FT                   /db_xref="InterPro:IPR014897"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF0"
FT                   /protein_id="CAK27459.1"
FT                   /translation="MCRQRQQNLDAGVTRRVLIFASATAMAVPTWLERMMALMRQTVQQ
FT                   TGIAPKPQPLAKPEPPKAAQASEQIFTGPKGGQYVLTASGKKKYLKK"
     MCRQRQQNLD AGVTRRVLIF ASATAMAVPT WLERMMALMR QTVQQTGIAP KPQPLAKPEP        60
     PKAAQASEQI FTGPKGGQYV LTASGKKKYL KK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page