(data stored in ACNUC29543 zone)

EMBL: CT978603.PE559

CT978603.PE559       Location/Qualifiers
FT   CDS             complement(495291..495632)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0559"
FT                   /locus_tag="SynRCC307_0559"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27462"
FT                   /db_xref="GOA:A5GRF3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF3"
FT                   /protein_id="CAK27462.1"
FT                   /translation="MHSRITAYLSSKVSSDPEGFTLVEVLVAGILMAGIMIGVSRLSTS
FT                   ALASSAKQAERQRIEASISNNIQMLQMEDSYLRFEDMSNEQQVRGCKNPTMELEAHLSQ
FT                   KVPAPDHQA"
     MHSRITAYLS SKVSSDPEGF TLVEVLVAGI LMAGIMIGVS RLSTSALASS AKQAERQRIE        60
     ASISNNIQML QMEDSYLRFE DMSNEQQVRG CKNPTMELEA HLSQKVPAPD HQA              113
//

If you have problems or comments...

PBIL Back to PBIL home page