(data stored in ACNUC29543 zone)

EMBL: CT978603.PE564

CT978603.PE564       Location/Qualifiers
FT   CDS             499459..499854
FT                   /transl_table=11
FT                   /gene="SynRCC307_0564"
FT                   /locus_tag="SynRCC307_0564"
FT                   /product="Putative PAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27467"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF8"
FT                   /protein_id="CAK27467.1"
FT                   /translation="MAEQWTPGAVAALREKENLPFVRADARGNIVEFNARFAEVYGWVE
FT                   GQLVGESISAILPPSFREFHHAGFARFQLTESSKVVGHPLTLATVCSDGSEVQSEHYIV
FT                   AEKYPDGSWSFAATLRPLEGEHASDQE"
     MAEQWTPGAV AALREKENLP FVRADARGNI VEFNARFAEV YGWVEGQLVG ESISAILPPS        60
     FREFHHAGFA RFQLTESSKV VGHPLTLATV CSDGSEVQSE HYIVAEKYPD GSWSFAATLR       120
     PLEGEHASDQ E                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page