(data stored in ACNUC29543 zone)

EMBL: CT978603.PE571

CT978603.PE571       Location/Qualifiers
FT   CDS             507135..507407
FT                   /transl_table=11
FT                   /gene="SynRCC307_0571"
FT                   /locus_tag="SynRCC307_0571"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27474"
FT                   /db_xref="GOA:A5GRG5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG5"
FT                   /protein_id="CAK27474.1"
FT                   /translation="MGVSLLLIGLTGLFWFLGMRNADEVIGILEKLMATLLLVLTLCVG
FT                   GGHVAISLLLLAVALSLPRARAFASTRFRSNSKITRESGELFLPF"
     MGVSLLLIGL TGLFWFLGMR NADEVIGILE KLMATLLLVL TLCVGGGHVA ISLLLLAVAL        60
     SLPRARAFAS TRFRSNSKIT RESGELFLPF                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page