(data stored in ACNUC29543 zone)

EMBL: CT978603.PE578

CT978603.PE578       Location/Qualifiers
FT   CDS             complement(513434..513646)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0578"
FT                   /locus_tag="SynRCC307_0578"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27481"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH2"
FT                   /protein_id="CAK27481.1"
FT                   /translation="MSQPAINVGSKVKITRVRDRIPADLVKLLLGNSEGTVTGFKMTDG
FT                   SGVGVKVKLEGGPETWFFQDEIAPA"
     MSQPAINVGS KVKITRVRDR IPADLVKLLL GNSEGTVTGF KMTDGSGVGV KVKLEGGPET        60
     WFFQDEIAPA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page