(data stored in ACNUC29543 zone)

EMBL: CT978603.PE58

CT978603.PE58        Location/Qualifiers
FT   CDS             complement(53763..54281)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0058"
FT                   /locus_tag="SynRCC307_0058"
FT                   /product="Tetratricopeptide repeat domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26961"
FT                   /db_xref="GOA:A5GQ02"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ02"
FT                   /protein_id="CAK26961.1"
FT                   /translation="MDFALPQAYLLGLIVLLGVVAVVVGRQVLRVRKQEGQLASLESRC
FT                   QDSKADAASLYELGSVQLDKRLFAQAASSLKRAAKLSASEPAEARALIQNALGFALAAQ
FT                   QNHKDAVRHYRLALKARGDYPVALNNLAYSLEKQQKGDEAVELYQRSLELEPGNRTATK
FT                   RLKLLRPNG"
     MDFALPQAYL LGLIVLLGVV AVVVGRQVLR VRKQEGQLAS LESRCQDSKA DAASLYELGS        60
     VQLDKRLFAQ AASSLKRAAK LSASEPAEAR ALIQNALGFA LAAQQNHKDA VRHYRLALKA       120
     RGDYPVALNN LAYSLEKQQK GDEAVELYQR SLELEPGNRT ATKRLKLLRP NG               172
//

If you have problems or comments...

PBIL Back to PBIL home page