(data stored in ACNUC29543 zone)

EMBL: CT978603.PE580

CT978603.PE580       Location/Qualifiers
FT   CDS             514522..514761
FT                   /transl_table=11
FT                   /gene="SynRCC307_0580"
FT                   /locus_tag="SynRCC307_0580"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27483"
FT                   /db_xref="GOA:A5GRH4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH4"
FT                   /protein_id="CAK27483.1"
FT                   /translation="MGFNGLDLLPGLIGLLLVAVVITLVAWALNLMQSASDSNEFSLML
FT                   AGCLVCSAAVGLSTVMVISLTGPNAPLVHIFHAG"
     MGFNGLDLLP GLIGLLLVAV VITLVAWALN LMQSASDSNE FSLMLAGCLV CSAAVGLSTV        60
     MVISLTGPNA PLVHIFHAG                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page