(data stored in ACNUC29543 zone)

EMBL: CT978603.PE582

CT978603.PE582       Location/Qualifiers
FT   CDS             complement(515447..516943)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0582"
FT                   /locus_tag="SynRCC307_0582"
FT                   /product="Carbohydrate-selective porin OprB related
FT                   protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27485"
FT                   /db_xref="GOA:A5GRH6"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH6"
FT                   /protein_id="CAK27485.1"
FT                   /translation="MAVLAAQWTLNKLSHFAIAGIRPPLISESLGEAEPMALSSRFSLA
FT                   LLALSLSWLPAPVGAEPADQPKPAKQPKVMETPRGLLEAATFGEMLGLPDWMAMSLSLV
FT                   NQPMGNITGSKQRTFRSIDMQAIDWSLGSGLSKEDSDKDEFDRWSFRSSLATYIGVPPY
FT                   FSEDIGAAFPLQALEDTEGLQQGFWLQGLWLQRDSENLSLKFGNNLSLDPLVESPVYNA
FT                   YVNSTINSTLNLSLPGYPTVPFSSLGASLQWRANDRLTVNYGGYQLSNQRTGFPAGRWK
FT                   GWRFNLDRDDGLVQALRLDWALSETSGEPLLICMSQEHPDVVVRHHQGCKRPMRLENKL
FT                   PDPVLQLGAVSGSWRFPQINNPSRWENRANSIFASATLPVPFALGHGSRLWGSAVIGTE
FT                   PAINPVPLFLEGGWITQGVIRQRPFDSVVLGLTRSSFSPSLGRASGQRMTYEGMIELGY
FT                   ILQLSQELALQPGVQVIVNPEGTGDNETLVVPGLQVSFNW"
     MAVLAAQWTL NKLSHFAIAG IRPPLISESL GEAEPMALSS RFSLALLALS LSWLPAPVGA        60
     EPADQPKPAK QPKVMETPRG LLEAATFGEM LGLPDWMAMS LSLVNQPMGN ITGSKQRTFR       120
     SIDMQAIDWS LGSGLSKEDS DKDEFDRWSF RSSLATYIGV PPYFSEDIGA AFPLQALEDT       180
     EGLQQGFWLQ GLWLQRDSEN LSLKFGNNLS LDPLVESPVY NAYVNSTINS TLNLSLPGYP       240
     TVPFSSLGAS LQWRANDRLT VNYGGYQLSN QRTGFPAGRW KGWRFNLDRD DGLVQALRLD       300
     WALSETSGEP LLICMSQEHP DVVVRHHQGC KRPMRLENKL PDPVLQLGAV SGSWRFPQIN       360
     NPSRWENRAN SIFASATLPV PFALGHGSRL WGSAVIGTEP AINPVPLFLE GGWITQGVIR       420
     QRPFDSVVLG LTRSSFSPSL GRASGQRMTY EGMIELGYIL QLSQELALQP GVQVIVNPEG       480
     TGDNETLVVP GLQVSFNW                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page