(data stored in ACNUC29543 zone)

EMBL: CT978603.PE590

CT978603.PE590       Location/Qualifiers
FT   CDS             complement(525202..525444)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0590"
FT                   /locus_tag="SynRCC307_0590"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27493"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI4"
FT                   /protein_id="CAK27493.1"
FT                   /translation="MALRSLLEESLPESLFGNTDRFSWHATPVGIAALWTGKVVPTSPP
FT                   FEQALEEGMTVGLDLSREEREFHQVRQGLVLLFHS"
     MALRSLLEES LPESLFGNTD RFSWHATPVG IAALWTGKVV PTSPPFEQAL EEGMTVGLDL        60
     SREEREFHQV RQGLVLLFHS                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page