(data stored in ACNUC29543 zone)

EMBL: CT978603.PE595

CT978603.PE595       Location/Qualifiers
FT   CDS             complement(529463..530065)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SynRCC307_0595"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27498"
FT                   /db_xref="GOA:A5GRI9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI9"
FT                   /protein_id="CAK27498.1"
FT                   /translation="MPIGTPSVPYRLPGSQYERWVDIYTRLGVERILFLGGEVNDGVAN
FT                   ALVAQMLYLDSDDSSKPIYLYINSPGGSVTAGLAIYDTIQYIKSDVVTICVGLAASMGA
FT                   FLLAAGTKGKRVALPHSRIMIHQPLGGTAQRQASDIEIEAREILRMKDQLNKQLADMSG
FT                   QTIEKITKDTDRDYFLSADDAKAYGLIDRVISHPSEA"
     MPIGTPSVPY RLPGSQYERW VDIYTRLGVE RILFLGGEVN DGVANALVAQ MLYLDSDDSS        60
     KPIYLYINSP GGSVTAGLAI YDTIQYIKSD VVTICVGLAA SMGAFLLAAG TKGKRVALPH       120
     SRIMIHQPLG GTAQRQASDI EIEAREILRM KDQLNKQLAD MSGQTIEKIT KDTDRDYFLS       180
     ADDAKAYGLI DRVISHPSEA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page