(data stored in ACNUC29543 zone)

EMBL: CT978603.PE597

CT978603.PE597       Location/Qualifiers
FT   CDS             complement(530805..531932)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0597"
FT                   /locus_tag="SynRCC307_0597"
FT                   /product="Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27500"
FT                   /db_xref="GOA:A5GRJ1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ1"
FT                   /protein_id="CAK27500.1"
FT                   /translation="MAISLANSRRSRSPRPSSLIVEALLLLLFVISGAAAGFLGVDLLP
FT                   PRMLIQVTNLEGLQWVMGGFGAFFGLIAGFLFQRLRAQLMRQVRTMPTDLLISRAVGLI
FT                   LGLLVANLLLAPILLLPLPWEVGFVKPLAAVLSNVFFGVSGYNLAEVHGRTLLRLFNPS
FT                   STEALLVADGVLQPASPKIVDTSLIIDGRLRGLLESEILEGQVIVAQCVIDELQQLADS
FT                   GNSDKRSKGRRGLKLLAELRDSYGRRLIVNSTRYEGDGVDDKLLKLCSDTGGLLLTTDY
FT                   NLAKVAQVQNLRALNLSELVISLRPEVQPGDLLQLKIVREGKEADQGVGYLEDGTMVVV
FT                   ESGRGSIGERREVTVTGALQTPAGRMVFARTADAR"
     MAISLANSRR SRSPRPSSLI VEALLLLLFV ISGAAAGFLG VDLLPPRMLI QVTNLEGLQW        60
     VMGGFGAFFG LIAGFLFQRL RAQLMRQVRT MPTDLLISRA VGLILGLLVA NLLLAPILLL       120
     PLPWEVGFVK PLAAVLSNVF FGVSGYNLAE VHGRTLLRLF NPSSTEALLV ADGVLQPASP       180
     KIVDTSLIID GRLRGLLESE ILEGQVIVAQ CVIDELQQLA DSGNSDKRSK GRRGLKLLAE       240
     LRDSYGRRLI VNSTRYEGDG VDDKLLKLCS DTGGLLLTTD YNLAKVAQVQ NLRALNLSEL       300
     VISLRPEVQP GDLLQLKIVR EGKEADQGVG YLEDGTMVVV ESGRGSIGER REVTVTGALQ       360
     TPAGRMVFAR TADAR                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page