(data stored in ACNUC29543 zone)

EMBL: CT978603.PE606

CT978603.PE606       Location/Qualifiers
FT   CDS             540066..541121
FT                   /transl_table=11
FT                   /gene="SynRCC307_0606"
FT                   /locus_tag="SynRCC307_0606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27509"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK0"
FT                   /protein_id="CAK27509.1"
FT                   /translation="MLSPDAPVLLLQHGGLFDLSGKTGLAFLRYRQGPVVAVLDPGHAG
FT                   ADLPLLTGIPRPVPVVGSVAEAMVYGPQVAVVGLAPSGGVLPEPVRQSVLEALRSGLSV
FT                   ASGLHTQLAADPELQAAVQPGSWIWDLRQEPAGLGVAAARAASLPCRRILAVGTDMSVG
FT                   KMSAALELTAAARQRGLDARFVGTGQAGILIAGGGVPLDAVRVDYAAGAVEQAVLQVAE
FT                   GAGEESIVFVEGQGSFCHPGSTATLPLMRGSQANSLLLVHRAGQRSIRNLPEIALPPLP
FT                   ELIAVVEALARLGRPPGLAPARVKAIALNTAQLDDRQAAAAIEQTAQDTGCCCADPVRG
FT                   GADRLLEALLS"
     MLSPDAPVLL LQHGGLFDLS GKTGLAFLRY RQGPVVAVLD PGHAGADLPL LTGIPRPVPV        60
     VGSVAEAMVY GPQVAVVGLA PSGGVLPEPV RQSVLEALRS GLSVASGLHT QLAADPELQA       120
     AVQPGSWIWD LRQEPAGLGV AAARAASLPC RRILAVGTDM SVGKMSAALE LTAAARQRGL       180
     DARFVGTGQA GILIAGGGVP LDAVRVDYAA GAVEQAVLQV AEGAGEESIV FVEGQGSFCH       240
     PGSTATLPLM RGSQANSLLL VHRAGQRSIR NLPEIALPPL PELIAVVEAL ARLGRPPGLA       300
     PARVKAIALN TAQLDDRQAA AAIEQTAQDT GCCCADPVRG GADRLLEALL S                351
//

If you have problems or comments...

PBIL Back to PBIL home page