(data stored in ACNUC29543 zone)

EMBL: CT978603.PE609

CT978603.PE609       Location/Qualifiers
FT   CDS             complement(542953..543423)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0609"
FT                   /locus_tag="SynRCC307_0609"
FT                   /product="Secreted pentapeptide repeats protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27512"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK3"
FT                   /protein_id="CAK27512.1"
FT                   /translation="MLRLLVVLLLNLSLLWPLQPAMASGSYLEKTDYTLTNQSDADFSG
FT                   QDLEGSSFAGAVVRNADFSGAKLHGAIFTQGAFAGSNFAGADLSDVLMDRADFTGTNLS
FT                   GTNLSGVVANGSSFAKAEIEGADFTGALLDRDDQITLCRKAKGETRLSLDCP"
     MLRLLVVLLL NLSLLWPLQP AMASGSYLEK TDYTLTNQSD ADFSGQDLEG SSFAGAVVRN        60
     ADFSGAKLHG AIFTQGAFAG SNFAGADLSD VLMDRADFTG TNLSGTNLSG VVANGSSFAK       120
     AEIEGADFTG ALLDRDDQIT LCRKAKGETR LSLDCP                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page