(data stored in ACNUC29543 zone)

EMBL: CT978603.PE61

CT978603.PE61        Location/Qualifiers
FT   CDS             54795..56480
FT                   /transl_table=11
FT                   /gene="SynRCC307_0061"
FT                   /locus_tag="SynRCC307_0061"
FT                   /product="SpoIID sporulation protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26964"
FT                   /db_xref="GOA:A5GQ05"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ05"
FT                   /protein_id="CAK26964.1"
FT                   /translation="MWNARRRMNLPLPVTRKRLAAARRVLSFGMSDALRTNNQVTGRTS
FT                   LSPSFSFIPWIGLTLPLVLVAGCRSAPRATEVPPKPVVPLHWPTQPAPPLQGDNPELWV
FT                   SLAPHLPQFRGGVPTDLLLRAAAGTLLLTTADGERWQGSAFPVRWSQVPLAQPLTIQRQ
FT                   VLGPFASHESALQQAEAWQQQGAEAVVAHPADWEVWAPLGSPDPGQPSRLVSETQTESW
FT                   QPVLDRQGTPTVIQGPLQIDAPEGLRWGGAVYRGRFRLQRDAYGSWTLLQQVPMESYLL
FT                   GVVPHEIGAGSPLEALKAQTVLARTWAMANRGRFAVDGYHLCSDTQCQVYSDPSAAGGA
FT                   VRQALASTAGQVLTWDGKALHGVYSASNGGVSSGLEEVWQASAQPYLKPAVDGPAPLPQ
FT                   QFPLPIQGDGSVRSLLGNRNFYGAGHPRFRWTRRYSATRLEQLAAAAGSPIGGAEAVSV
FT                   GGRGPSGRVLQLTVVGTDGRWVLERDQIRRQLRALPSTLFVVEQESPAAWLFDGGGFGH
FT                   GAGLSQAGAIDLASRGWSSERILRHYFPGAELQPVKNLSSQVSP"
     MWNARRRMNL PLPVTRKRLA AARRVLSFGM SDALRTNNQV TGRTSLSPSF SFIPWIGLTL        60
     PLVLVAGCRS APRATEVPPK PVVPLHWPTQ PAPPLQGDNP ELWVSLAPHL PQFRGGVPTD       120
     LLLRAAAGTL LLTTADGERW QGSAFPVRWS QVPLAQPLTI QRQVLGPFAS HESALQQAEA       180
     WQQQGAEAVV AHPADWEVWA PLGSPDPGQP SRLVSETQTE SWQPVLDRQG TPTVIQGPLQ       240
     IDAPEGLRWG GAVYRGRFRL QRDAYGSWTL LQQVPMESYL LGVVPHEIGA GSPLEALKAQ       300
     TVLARTWAMA NRGRFAVDGY HLCSDTQCQV YSDPSAAGGA VRQALASTAG QVLTWDGKAL       360
     HGVYSASNGG VSSGLEEVWQ ASAQPYLKPA VDGPAPLPQQ FPLPIQGDGS VRSLLGNRNF       420
     YGAGHPRFRW TRRYSATRLE QLAAAAGSPI GGAEAVSVGG RGPSGRVLQL TVVGTDGRWV       480
     LERDQIRRQL RALPSTLFVV EQESPAAWLF DGGGFGHGAG LSQAGAIDLA SRGWSSERIL       540
     RHYFPGAELQ PVKNLSSQVS P                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page