(data stored in ACNUC29543 zone)

EMBL: CT978603.PE613

CT978603.PE613       Location/Qualifiers
FT   CDS             547613..547861
FT                   /transl_table=11
FT                   /gene="SynRCC307_0613"
FT                   /locus_tag="SynRCC307_0613"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27516"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK7"
FT                   /protein_id="CAK27516.1"
FT                   /translation="MIVLKISNASDVVASKVGRFLERLTPDSLDEAKVEEEVIKKLVEN
FT                   LRTEGIEGSVASVKGLDLSPEGIVMKNDIHLRRFEQI"
     MIVLKISNAS DVVASKVGRF LERLTPDSLD EAKVEEEVIK KLVENLRTEG IEGSVASVKG        60
     LDLSPEGIVM KNDIHLRRFE QI                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page