(data stored in ACNUC29543 zone)

EMBL: CT978603.PE619

CT978603.PE619       Location/Qualifiers
FT   CDS             complement(553491..557129)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0619"
FT                   /locus_tag="SynRCC307_0619"
FT                   /product="Putative outer membrane protein, contains Hep_Hag
FT                   repeats"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27522"
FT                   /db_xref="GOA:A5GRL3"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL3"
FT                   /protein_id="CAK27522.1"
FT                   /translation="MRAPLKLALGTGAFVLIGSSPALAQIGLCTVNPASDLIFAGAGSP
FT                   LIFSGAGATPFTVEGGGSPLVITGNGGAAVEVGGTFTAACEGIYCEGIGDVTIDGAGGF
FT                   EIGGASEYTIMGEGLSSFTMDGEYTFTSEGAFSATACGSEANTGSFASGLGSTANGVEA
FT                   VALGIAAAAGGAQNVVVGTTAGGDGDQITVLGNNITADGDQAIAIGNEAAAGGALSIAI
FT                   GNEAEAGTTAGVAIGANVGGNGLAITVLGANATADGDQGVAVGQGAGAAGAQTVAIGNG
FT                   AQAGGAGTISIGNGVSANGDAIVALGTGVQVTASDTIAIGNGVTSNASQSNVLIGSGIA
FT                   SVATYDNVVIGKDIGSLGAAGNIVIGSGDGDLGTAASIMLGNGVAAAGMSGNILMGNDA
FT                   TAEFSVGSVAIGNSVNIGGNAGGVVIGNGATADGGVNQVVIGNGVVSVANSTVVIGDSA
FT                   MTSDDADGAIAIGSQTRATAVDALAMVSATASGESSIAIGSTAEATQYGSIAFGGDASS
FT                   TKLGAIAIGANTSVSGETGIALGYQSSVSGTNAIAIGANTSATCANSFVLGAGAIANGT
FT                   GAGAIGYLANTQGSDAMAIGVQACALGDNSMALGTSAISKGIDSVAIGYSACSSATNSS
FT                   AIGTNATANGTNSMAFGANSLASGINATAIGANAWADQTNSIVIGPNARACGVNAGAIG
FT                   ASANANGESSLAIGVKSFAKETSSLALGTNASSIGTNSTAIAVNASSTGANSMAIGYFS
FT                   TSNGVNSSALAVKANASGDNSVALGVFANAQGGNSLAFGTCSIASGTNATAISSDASAT
FT                   GNNSIAIGVDSIASQENAQSFGVKARAEGINAVAIAAGSFANGENSMAIGVLANATALN
FT                   TAAIGTFARASQNGALAFGSNASATANYAMALGVNALANSNGAIAIGRYANAVSTETFA
FT                   AGALHKPSTTTPWPLAAMPKQPAPTPWRLAPEATPSTTTPLQLVLRQKRSDTTPWRLVF
FT                   SPKRCKPTAWPTEPEPMPVPSMPWLPAQTHKHLVSHQSPPAPKRKPAKPGLLPSGPAAV
FT                   QQGFKPLPWVVRQKRPAHMPSQLASTVWPIKLARLQLARKPKPPPMGPWHWLLSPMPAA
FT                   QTPSPPVTTHLLQAITPSPLALVPVPQLEMLSPQACKPMRAVPPLLPSAPTPSLAVSIP
FT                   LPSAPHHKPLISMPIPLAWKASPVLKMRPLLAPWPKPQELTHLRLD"
     MRAPLKLALG TGAFVLIGSS PALAQIGLCT VNPASDLIFA GAGSPLIFSG AGATPFTVEG        60
     GGSPLVITGN GGAAVEVGGT FTAACEGIYC EGIGDVTIDG AGGFEIGGAS EYTIMGEGLS       120
     SFTMDGEYTF TSEGAFSATA CGSEANTGSF ASGLGSTANG VEAVALGIAA AAGGAQNVVV       180
     GTTAGGDGDQ ITVLGNNITA DGDQAIAIGN EAAAGGALSI AIGNEAEAGT TAGVAIGANV       240
     GGNGLAITVL GANATADGDQ GVAVGQGAGA AGAQTVAIGN GAQAGGAGTI SIGNGVSANG       300
     DAIVALGTGV QVTASDTIAI GNGVTSNASQ SNVLIGSGIA SVATYDNVVI GKDIGSLGAA       360
     GNIVIGSGDG DLGTAASIML GNGVAAAGMS GNILMGNDAT AEFSVGSVAI GNSVNIGGNA       420
     GGVVIGNGAT ADGGVNQVVI GNGVVSVANS TVVIGDSAMT SDDADGAIAI GSQTRATAVD       480
     ALAMVSATAS GESSIAIGST AEATQYGSIA FGGDASSTKL GAIAIGANTS VSGETGIALG       540
     YQSSVSGTNA IAIGANTSAT CANSFVLGAG AIANGTGAGA IGYLANTQGS DAMAIGVQAC       600
     ALGDNSMALG TSAISKGIDS VAIGYSACSS ATNSSAIGTN ATANGTNSMA FGANSLASGI       660
     NATAIGANAW ADQTNSIVIG PNARACGVNA GAIGASANAN GESSLAIGVK SFAKETSSLA       720
     LGTNASSIGT NSTAIAVNAS STGANSMAIG YFSTSNGVNS SALAVKANAS GDNSVALGVF       780
     ANAQGGNSLA FGTCSIASGT NATAISSDAS ATGNNSIAIG VDSIASQENA QSFGVKARAE       840
     GINAVAIAAG SFANGENSMA IGVLANATAL NTAAIGTFAR ASQNGALAFG SNASATANYA       900
     MALGVNALAN SNGAIAIGRY ANAVSTETFA AGALHKPSTT TPWPLAAMPK QPAPTPWRLA       960
     PEATPSTTTP LQLVLRQKRS DTTPWRLVFS PKRCKPTAWP TEPEPMPVPS MPWLPAQTHK      1020
     HLVSHQSPPA PKRKPAKPGL LPSGPAAVQQ GFKPLPWVVR QKRPAHMPSQ LASTVWPIKL      1080
     ARLQLARKPK PPPMGPWHWL LSPMPAAQTP SPPVTTHLLQ AITPSPLALV PVPQLEMLSP      1140
     QACKPMRAVP PLLPSAPTPS LAVSIPLPSA PHHKPLISMP IPLAWKASPV LKMRPLLAPW      1200
     PKPQELTHLR LD                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page