(data stored in ACNUC29543 zone)

EMBL: CT978603.PE623

CT978603.PE623       Location/Qualifiers
FT   CDS             558953..559240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0623"
FT                   /locus_tag="SynRCC307_0623"
FT                   /product="Thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27526"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL7"
FT                   /protein_id="CAK27526.1"
FT                   /translation="MMAMADLSWPALTLITRQGCCLCEGLQERLEALDPAPPLQCVDVD
FT                   GDAQLQARFGLEVPVLMTASGEVLARVPPRLSGDRLADWLQRSLNSSNSA"
     MMAMADLSWP ALTLITRQGC CLCEGLQERL EALDPAPPLQ CVDVDGDAQL QARFGLEVPV        60
     LMTASGEVLA RVPPRLSGDR LADWLQRSLN SSNSA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page