(data stored in ACNUC29543 zone)

EMBL: CT978603.PE629

CT978603.PE629       Location/Qualifiers
FT   CDS             complement(566095..569133)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0629"
FT                   /locus_tag="SynRCC307_0629"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27532"
FT                   /db_xref="GOA:A5GRM3"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM3"
FT                   /protein_id="CAK27532.1"
FT                   /translation="MNSRLLLISAVLRAAGFRRGNQTRRSSRSRRWSRAAQTLFASWAV
FT                   LGQPGSMGLLVAEVIQPQLAKANPPMAGDSSGKATSTGTGAFAIGIGATANGNYSQALG
FT                   YEANAKGDAIAIGSCASSSGWRSIALGVDAQSSGEDSYAIGKSSKASLNYSLALGVGAN
FT                   AAAQDAIAVGRGASALTANSIAIGQSAEVSSQKNAVAIGTKASASGLRSTALGAGSVAS
FT                   GKNSTAVGTGAATTRADQLMLGKAATEVTIANLGYANDNKYHLVTVDTDGTLRQKPFVD
FT                   VGFEIDISGRGALIKPGENIRISSINGANDDGYYGGAVTISAKGVELQAGENVFISEQE
FT                   SGLTTSYTVSGLQTTVSAADDKVIVTKQGGSNEANNYTTDYSIGINISDNAYNALKCEG
FT                   NGVNAVCYGPGANATGIGTTAIGAYANATTTLSTIDLGSTAVGFLATASGVKSAAFGRA
FT                   AQASAQSALALGAGAQATHANAVAIGPGATTTLESRITIGTGTTSYQTPGLTASTTDVA
FT                   VVVTNQTGVLRAATFAAQNLPNSYCLSGGAGATCYGQEADATGAGTTAMGAGALANSGA
FT                   GAANLTAATALGTLSKATGGGSTSLGVQANASGEGSISAGMNSTAAGRGSLAYGFGANA
FT                   SAENTIAIGGFADADGQNSYAIGAGAVANGVGAIAIGPGSKALGYNTNATAIGAGAVAD
FT                   GTSATSIGASSYSSGVNVTALGAGARATHTSSTAVGTGAVTTRDNHTVIGTSTTEVTMP
FT                   NLAGAGTAIVAANEDGTLQRSSVSLGDLDNAVNKRLPKLESAARSLGNAVEAAGAMGAA
FT                   LSSLPEVSLAQDEPVRCGFGAGGWGSQYSVAGGCAARVADRLHVNGAIAYTPSVDYEFG
FT                   STPSVGGRVGFSFPLGKLNKPKPSDPQPEQAADPAPQADPVRGLWKTSPIGSETLYVEK
FT                   IAKLTEQLEQLQQSAGSSEANEQLIALLRERIEELEAEKELASAENQRQDDKIKQLETK
FT                   LSQQQSLMERMMKQMKKLMPNGG"
     MNSRLLLISA VLRAAGFRRG NQTRRSSRSR RWSRAAQTLF ASWAVLGQPG SMGLLVAEVI        60
     QPQLAKANPP MAGDSSGKAT STGTGAFAIG IGATANGNYS QALGYEANAK GDAIAIGSCA       120
     SSSGWRSIAL GVDAQSSGED SYAIGKSSKA SLNYSLALGV GANAAAQDAI AVGRGASALT       180
     ANSIAIGQSA EVSSQKNAVA IGTKASASGL RSTALGAGSV ASGKNSTAVG TGAATTRADQ       240
     LMLGKAATEV TIANLGYAND NKYHLVTVDT DGTLRQKPFV DVGFEIDISG RGALIKPGEN       300
     IRISSINGAN DDGYYGGAVT ISAKGVELQA GENVFISEQE SGLTTSYTVS GLQTTVSAAD       360
     DKVIVTKQGG SNEANNYTTD YSIGINISDN AYNALKCEGN GVNAVCYGPG ANATGIGTTA       420
     IGAYANATTT LSTIDLGSTA VGFLATASGV KSAAFGRAAQ ASAQSALALG AGAQATHANA       480
     VAIGPGATTT LESRITIGTG TTSYQTPGLT ASTTDVAVVV TNQTGVLRAA TFAAQNLPNS       540
     YCLSGGAGAT CYGQEADATG AGTTAMGAGA LANSGAGAAN LTAATALGTL SKATGGGSTS       600
     LGVQANASGE GSISAGMNST AAGRGSLAYG FGANASAENT IAIGGFADAD GQNSYAIGAG       660
     AVANGVGAIA IGPGSKALGY NTNATAIGAG AVADGTSATS IGASSYSSGV NVTALGAGAR       720
     ATHTSSTAVG TGAVTTRDNH TVIGTSTTEV TMPNLAGAGT AIVAANEDGT LQRSSVSLGD       780
     LDNAVNKRLP KLESAARSLG NAVEAAGAMG AALSSLPEVS LAQDEPVRCG FGAGGWGSQY       840
     SVAGGCAARV ADRLHVNGAI AYTPSVDYEF GSTPSVGGRV GFSFPLGKLN KPKPSDPQPE       900
     QAADPAPQAD PVRGLWKTSP IGSETLYVEK IAKLTEQLEQ LQQSAGSSEA NEQLIALLRE       960
     RIEELEAEKE LASAENQRQD DKIKQLETKL SQQQSLMERM MKQMKKLMPN GG              1012
//

If you have problems or comments...

PBIL Back to PBIL home page