(data stored in ACNUC29543 zone)

EMBL: CT978603.PE631

CT978603.PE631       Location/Qualifiers
FT   CDS             570445..573639
FT                   /transl_table=11
FT                   /gene="SynRCC307_0631"
FT                   /locus_tag="SynRCC307_0631"
FT                   /product="Predicted O-linked N-acetylglucosamine
FT                   transferase with TPR domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27534"
FT                   /db_xref="GOA:A5GRM5"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM5"
FT                   /protein_id="CAK27534.1"
FT                   /translation="MAASISASTLVAVNARLCIAPLPKVASTLLKRVAVLADGREPLST
FT                   TSLGETRPALAIHRAEVHGLPCLAELSQEQQEHWLGDAHALRLVVTRHPAERLLSFWHD
FT                   KLHLAEPAYAPLNASVQAARQRSGADPCRFADFLSFLEEHWELLKSDGHLRPQCDLLGD
FT                   APGFQRLDRDGLVKQLPRLLQPLVPAATLGRIKDELATYDKQYRQRLGKRWEDAYSKDG
FT                   LQLVESLYGDDLKRYGYSMPRRRSDKVRPLAAVDTDALVDPLQQLRERHQQIAGLQQQL
FT                   AEAQQALAKPPLPSIDPPQGQWPDHNSPEAGLSHLYDALNEQRFQEVIEQAASLQGHPH
FT                   AGEIAYIQGLAHGALGEHQAAIDAYVAAQAAGFLTPYVLFNAGNSCRGLGNTAEGLRLY
FT                   QEAIDLFPAFAEARHNLAMALLENQDTAEAERQLRLLLRDQPSYYQASFCLANLLRDLK
FT                   RDPEAVEAFRLCLHYAPNYPDAWNNLGLTYGNLKQMDEAIASYRHALSINADFKPSRQN
FT                   LAQALVQLKHHDEAYQEFGLFRRLDLSPTEQVVGLQGQINCLMELDRYEEGLALADAEP
FT                   DRRLQLMARLHVLPVLYDSSEQVSATRQRWHDDATELYGLLDGISQDDPHWEHLYGHAW
FT                   SLTNFYLAYQMEDDRPLQELYAGILDRILRPKLGAFMQPLPQRHPGDTSPLRVGVISPH
FT                   LVNHNGSIWALGWLEGIANNSGYEIFSYNVADNEDSGTQRFAALGTYRHLPLCAEAPEA
FT                   MLQQILDDRLDLLIYTDIGMHPASKITSVLQLAPVQGQGWGHPITSGSRTIHYYLSGEG
FT                   MEPSGNEEHYSETLWRLPRTGLNYDTPAAIHDGELLFDKFDLPRDRPILNSLQSTFKYV
FT                   PRNDWSFAEIAKRNPEAFIVLVGHMGHGGLCERLVERMRPHFEERGLELENHLRVLPRL
FT                   DYGDFMGLFSISHHTIDTIDWNGGNSSMQSFSLDCPVVTLPTAFMRGRHTVAMLEVLEL
FT                   PELIAQDGNDYVAISSRLLSDEAFYQEMRAKIAERKERLFHDKSVAEAFQLAVETICRQ
FT                   VPAVGQQPAEILPLAA"
     MAASISASTL VAVNARLCIA PLPKVASTLL KRVAVLADGR EPLSTTSLGE TRPALAIHRA        60
     EVHGLPCLAE LSQEQQEHWL GDAHALRLVV TRHPAERLLS FWHDKLHLAE PAYAPLNASV       120
     QAARQRSGAD PCRFADFLSF LEEHWELLKS DGHLRPQCDL LGDAPGFQRL DRDGLVKQLP       180
     RLLQPLVPAA TLGRIKDELA TYDKQYRQRL GKRWEDAYSK DGLQLVESLY GDDLKRYGYS       240
     MPRRRSDKVR PLAAVDTDAL VDPLQQLRER HQQIAGLQQQ LAEAQQALAK PPLPSIDPPQ       300
     GQWPDHNSPE AGLSHLYDAL NEQRFQEVIE QAASLQGHPH AGEIAYIQGL AHGALGEHQA       360
     AIDAYVAAQA AGFLTPYVLF NAGNSCRGLG NTAEGLRLYQ EAIDLFPAFA EARHNLAMAL       420
     LENQDTAEAE RQLRLLLRDQ PSYYQASFCL ANLLRDLKRD PEAVEAFRLC LHYAPNYPDA       480
     WNNLGLTYGN LKQMDEAIAS YRHALSINAD FKPSRQNLAQ ALVQLKHHDE AYQEFGLFRR       540
     LDLSPTEQVV GLQGQINCLM ELDRYEEGLA LADAEPDRRL QLMARLHVLP VLYDSSEQVS       600
     ATRQRWHDDA TELYGLLDGI SQDDPHWEHL YGHAWSLTNF YLAYQMEDDR PLQELYAGIL       660
     DRILRPKLGA FMQPLPQRHP GDTSPLRVGV ISPHLVNHNG SIWALGWLEG IANNSGYEIF       720
     SYNVADNEDS GTQRFAALGT YRHLPLCAEA PEAMLQQILD DRLDLLIYTD IGMHPASKIT       780
     SVLQLAPVQG QGWGHPITSG SRTIHYYLSG EGMEPSGNEE HYSETLWRLP RTGLNYDTPA       840
     AIHDGELLFD KFDLPRDRPI LNSLQSTFKY VPRNDWSFAE IAKRNPEAFI VLVGHMGHGG       900
     LCERLVERMR PHFEERGLEL ENHLRVLPRL DYGDFMGLFS ISHHTIDTID WNGGNSSMQS       960
     FSLDCPVVTL PTAFMRGRHT VAMLEVLELP ELIAQDGNDY VAISSRLLSD EAFYQEMRAK      1020
     IAERKERLFH DKSVAEAFQL AVETICRQVP AVGQQPAEIL PLAA                       1064
//

If you have problems or comments...

PBIL Back to PBIL home page