(data stored in ACNUC29543 zone)

EMBL: CT978603.PE632

CT978603.PE632       Location/Qualifiers
FT   CDS             573639..574505
FT                   /transl_table=11
FT                   /gene="SynRCC307_0632"
FT                   /locus_tag="SynRCC307_0632"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27535"
FT                   /db_xref="GOA:A5GRM6"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM6"
FT                   /protein_id="CAK27535.1"
FT                   /translation="MMQLQAHDLLPGCRVDDPACDWAQIQLQMREGVQLSPLLPLGGDA
FT                   GLVWVPKNGCSTLKRVWLQLQGADCQRPGFDPHSAALPFTHWLNPDELRAVSHYRFLVA
FT                   IWRDPIDRFVSACRSHLVELTTAAIYAKLRSSSPDQSGFENALRFHDELFAGHGVHSFA
FT                   DDADPVDVMNQTALQLPAWIACHIDWSHHTIPQVSFLGGDPRCYRTILGMEQIDALMAH
FT                   WSKASGLPLDLTPQHVSREQASNNPWRRLRRDQLSSEALAALERFYAADWAFLELAQQQ
FT                   LGAWQAA"
     MMQLQAHDLL PGCRVDDPAC DWAQIQLQMR EGVQLSPLLP LGGDAGLVWV PKNGCSTLKR        60
     VWLQLQGADC QRPGFDPHSA ALPFTHWLNP DELRAVSHYR FLVAIWRDPI DRFVSACRSH       120
     LVELTTAAIY AKLRSSSPDQ SGFENALRFH DELFAGHGVH SFADDADPVD VMNQTALQLP       180
     AWIACHIDWS HHTIPQVSFL GGDPRCYRTI LGMEQIDALM AHWSKASGLP LDLTPQHVSR       240
     EQASNNPWRR LRRDQLSSEA LAALERFYAA DWAFLELAQQ QLGAWQAA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page