(data stored in ACNUC29543 zone)

EMBL: CT978603.PE634

CT978603.PE634       Location/Qualifiers
FT   CDS             complement(575442..575615)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0634"
FT                   /locus_tag="SynRCC307_0634"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27537"
FT                   /db_xref="GOA:A5GRM8"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM8"
FT                   /protein_id="CAK27537.1"
FT                   /translation="MQQPPSRRDEITQQLAFAALGAGVITTVAVAQGQNPLTALGITVF
FT                   SAVAAVMVGQVL"
     MQQPPSRRDE ITQQLAFAAL GAGVITTVAV AQGQNPLTAL GITVFSAVAA VMVGQVL           57
//

If you have problems or comments...

PBIL Back to PBIL home page