(data stored in ACNUC29543 zone)

EMBL: CT978603.PE641

CT978603.PE641       Location/Qualifiers
FT   CDS             complement(579875..580456)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0641"
FT                   /locus_tag="SynRCC307_0641"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27544"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN5"
FT                   /protein_id="CAK27544.1"
FT                   /translation="MRFSHGVITACASAAIVAGGLQLPQALAQSSSGAFSILQQRWGNR
FT                   EGFKNLFYWVSETKPNRRSNYFLILGKNDRDKAIMKLDVMVPSYFDSKLKTKNIQLSYC
FT                   QGGEGAMKRTICEETIPAAISLVNDGKTIQIVPETPIPPDRTIGVVFRVANPSNGGMYQ
FT                   FNALAQAPGKVDIAGYLGSWVIEIQPGGAR"
     MRFSHGVITA CASAAIVAGG LQLPQALAQS SSGAFSILQQ RWGNREGFKN LFYWVSETKP        60
     NRRSNYFLIL GKNDRDKAIM KLDVMVPSYF DSKLKTKNIQ LSYCQGGEGA MKRTICEETI       120
     PAAISLVNDG KTIQIVPETP IPPDRTIGVV FRVANPSNGG MYQFNALAQA PGKVDIAGYL       180
     GSWVIEIQPG GAR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page