(data stored in ACNUC29543 zone)

EMBL: CT978603.PE642

CT978603.PE642       Location/Qualifiers
FT   CDS             complement(580544..581185)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0642"
FT                   /locus_tag="SynRCC307_0642"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27545"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN6"
FT                   /protein_id="CAK27545.1"
FT                   /translation="MTTGEGAEPHENQPTDVGHLMALRLRTVLGLGGAAALAGGIALSG
FT                   LSEVKAQSSVGTPGFSFRWNNTKDFKKLYYVISNQERDTWSDYTLILKGKDRKAAIIKL
FT                   DVTVPSYFDTTINPKEVALKYCSVGSALSRTRCKETIPATVELANDGKTLEIFPDSPVP
FT                   PNKAIGVVFPVYNPGSGMYQFNALAQAPGDVPMAGYLGSWVIEITDGIDG"
     MTTGEGAEPH ENQPTDVGHL MALRLRTVLG LGGAAALAGG IALSGLSEVK AQSSVGTPGF        60
     SFRWNNTKDF KKLYYVISNQ ERDTWSDYTL ILKGKDRKAA IIKLDVTVPS YFDTTINPKE       120
     VALKYCSVGS ALSRTRCKET IPATVELAND GKTLEIFPDS PVPPNKAIGV VFPVYNPGSG       180
     MYQFNALAQA PGDVPMAGYL GSWVIEITDG IDG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page