(data stored in ACNUC29543 zone)

EMBL: CT978603.PE651

CT978603.PE651       Location/Qualifiers
FT   CDS             complement(591475..591954)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0651"
FT                   /locus_tag="SynRCC307_0651"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27554"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP5"
FT                   /protein_id="CAK27554.1"
FT                   /translation="MSPIQRPTPRAPAQPLGQCLGQLERQWQSEGSLAALWQAWPEIAG
FT                   AQLAPHCRPLALRGNTLLVGASQPQWLQALRYSRHQLLAVLRSRGYAVNQLQFQQHDVS
FT                   KASEPFSAELARSWSEHPCRITGSSTDCPRCGAPSPSGEIERWGCCALCLHQQSS"
     MSPIQRPTPR APAQPLGQCL GQLERQWQSE GSLAALWQAW PEIAGAQLAP HCRPLALRGN        60
     TLLVGASQPQ WLQALRYSRH QLLAVLRSRG YAVNQLQFQQ HDVSKASEPF SAELARSWSE       120
     HPCRITGSST DCPRCGAPSP SGEIERWGCC ALCLHQQSS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page