(data stored in ACNUC29543 zone)

EMBL: CT978603.PE654

CT978603.PE654       Location/Qualifiers
FT   CDS             593122..594312
FT                   /transl_table=11
FT                   /gene="SynRCC307_0654"
FT                   /locus_tag="SynRCC307_0654"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27557"
FT                   /db_xref="GOA:A5GRP8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP8"
FT                   /protein_id="CAK27557.1"
FT                   /translation="MPISERLGQLGSGVFGRVDGEKRSYRLSQQQPQRPLIDLSLGSSD
FT                   LKPPVRLLQVMAEAIAEPPSSRYCLQAATAPFRQAAAAWLEGRFGVAVDPEKEILLLVG
FT                   SQEGTAHLPLAVLNPGDPALVLDPSYPSHAGGVALASGELVRLPLLADQGWRPAFEQLS
FT                   DEQRRQLRLLVLGYPHNPTATTGSQEWLEQAMAIAKRSDAVLAHDNPYVDLALEGEAPA
FT                   LLRCDGWRERGIEFFSFSKGWGLAGFRLAFAVGAPALIEALARVKGVVDFNQSLALQAG
FT                   AIAALQEFPDWPRQLCDRYRQRRDHMAELLTAAGWTVPNSSMALYQWLPIPEPLHDLGS
FT                   EAAAQWLLRSSGVALTPGVGFGPSGEGWLRLALVADEPVLEQASARLRLALEQRTI"
     MPISERLGQL GSGVFGRVDG EKRSYRLSQQ QPQRPLIDLS LGSSDLKPPV RLLQVMAEAI        60
     AEPPSSRYCL QAATAPFRQA AAAWLEGRFG VAVDPEKEIL LLVGSQEGTA HLPLAVLNPG       120
     DPALVLDPSY PSHAGGVALA SGELVRLPLL ADQGWRPAFE QLSDEQRRQL RLLVLGYPHN       180
     PTATTGSQEW LEQAMAIAKR SDAVLAHDNP YVDLALEGEA PALLRCDGWR ERGIEFFSFS       240
     KGWGLAGFRL AFAVGAPALI EALARVKGVV DFNQSLALQA GAIAALQEFP DWPRQLCDRY       300
     RQRRDHMAEL LTAAGWTVPN SSMALYQWLP IPEPLHDLGS EAAAQWLLRS SGVALTPGVG       360
     FGPSGEGWLR LALVADEPVL EQASARLRLA LEQRTI                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page