(data stored in ACNUC29543 zone)

EMBL: CT978603.PE666

CT978603.PE666       Location/Qualifiers
FT   CDS             complement(605170..605706)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0666"
FT                   /locus_tag="SynRCC307_0666"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27569"
FT                   /db_xref="GOA:A5GRR0"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR0"
FT                   /protein_id="CAK27569.1"
FT                   /translation="MVEMSVAGIALDAASRSPIVLLRDPSGRRQVPIWIDQAQAQNILA
FT                   GLHIKEPPRPLSHDLMATLLALGGLELNKVVIHAIEDSTFLAVLKLNDEDGEEHAIDCR
FT                   PSDAIALALRTGSSLWMLEEVVGDASIPVDAEADAEEVEDFHRFVEGLSPAELIRQQGL
FT                   AQPDPEPPLDDDGLD"
     MVEMSVAGIA LDAASRSPIV LLRDPSGRRQ VPIWIDQAQA QNILAGLHIK EPPRPLSHDL        60
     MATLLALGGL ELNKVVIHAI EDSTFLAVLK LNDEDGEEHA IDCRPSDAIA LALRTGSSLW       120
     MLEEVVGDAS IPVDAEADAE EVEDFHRFVE GLSPAELIRQ QGLAQPDPEP PLDDDGLD         178
//

If you have problems or comments...

PBIL Back to PBIL home page