(data stored in ACNUC29543 zone)

EMBL: CT978603.PE669

CT978603.PE669       Location/Qualifiers
FT   CDS             complement(606991..607404)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0669"
FT                   /locus_tag="SynRCC307_0669"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27572"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR3"
FT                   /protein_id="CAK27572.1"
FT                   /translation="MESTQPLVGDALLKRAGELSDRAPDQIARACGYTGNSGRVLKKAF
FT                   LRALVEAKGFVFPGKESSGSRGRQAEYRTKVHGNGNLLVGNVYTRKLGLVPGQECTIEL
FT                   HEETGTIWLRLPDDLVVDDAALEDEPSNQAADA"
     MESTQPLVGD ALLKRAGELS DRAPDQIARA CGYTGNSGRV LKKAFLRALV EAKGFVFPGK        60
     ESSGSRGRQA EYRTKVHGNG NLLVGNVYTR KLGLVPGQEC TIELHEETGT IWLRLPDDLV       120
     VDDAALEDEP SNQAADA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page