(data stored in ACNUC29543 zone)

EMBL: CT978603.PE680

CT978603.PE680       Location/Qualifiers
FT   CDS             615951..616127
FT                   /transl_table=11
FT                   /gene="SynRCC307_0680"
FT                   /locus_tag="SynRCC307_0680"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27583"
FT                   /db_xref="GOA:A5GRS4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS4"
FT                   /protein_id="CAK27583.1"
FT                   /translation="MTFLLLAALGVLMALIYLPLRIYLTLTARGRRLRLLQRIRLLRQQ
FT                   LGEELTSRSQVSS"
     MTFLLLAALG VLMALIYLPL RIYLTLTARG RRLRLLQRIR LLRQQLGEEL TSRSQVSS          58
//

If you have problems or comments...

PBIL Back to PBIL home page