(data stored in ACNUC29543 zone)

EMBL: CT978603.PE688

CT978603.PE688       Location/Qualifiers
FT   CDS             complement(622873..623700)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0688"
FT                   /locus_tag="SynRCC307_0688"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27591"
FT                   /db_xref="GOA:A5GRT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT2"
FT                   /protein_id="CAK27591.1"
FT                   /translation="MLQARTALGLSREQLAERLHMRPHQIEALECHQQERWPEAVFTIA
FT                   QVRRLAAALGLDAEPVVEAFRADLSQQTNEASPAAKAVFQLGRSEPTAQAKREEGQRDW
FT                   LHESKKDNKTKAKASPVRFQRPNWLVPSIGVVALLAIGGVAISRNLPALQGQLAAIPKL
FT                   WPKTPAKPSADAAVAATPKPQPKTLELSLSEPVWMSVRQLAGQKQLFEGLMQPGPHSFP
FT                   LGTGVQVLAGRPDLVMAHIGDQPAKALGSIETIQWVTFKPPVAAASATAPNAG"
     MLQARTALGL SREQLAERLH MRPHQIEALE CHQQERWPEA VFTIAQVRRL AAALGLDAEP        60
     VVEAFRADLS QQTNEASPAA KAVFQLGRSE PTAQAKREEG QRDWLHESKK DNKTKAKASP       120
     VRFQRPNWLV PSIGVVALLA IGGVAISRNL PALQGQLAAI PKLWPKTPAK PSADAAVAAT       180
     PKPQPKTLEL SLSEPVWMSV RQLAGQKQLF EGLMQPGPHS FPLGTGVQVL AGRPDLVMAH       240
     IGDQPAKALG SIETIQWVTF KPPVAAASAT APNAG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page