(data stored in ACNUC29543 zone)

EMBL: CT978603.PE691

CT978603.PE691       Location/Qualifiers
FT   CDS             624088..625419
FT                   /transl_table=11
FT                   /gene="SynRCC307_0691"
FT                   /locus_tag="SynRCC307_0691"
FT                   /product="Phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27594"
FT                   /db_xref="GOA:A5GRT5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT5"
FT                   /protein_id="CAK27594.1"
FT                   /translation="MRPSVWEPSTLCLMVSAESWGKALRRDIKNEYGPGWSVSAQSGKT
FT                   KLTRRYADGTRSSVMIEIPFSSGHKRELLIAIGTHAEQMAEQQISLKESRKRTAVTAAN
FT                   PEGVFVWDEAAKAFYETRKDLGPVTQRNTVTRIEKALDSLNRKPRPKDGLELLAAFERQ
FT                   HLQHLQPGSEGRKKSIQEVGKFLRFCVERRGLAGRWMPPVGEQRQELVGAAEGRDAKLT
FT                   PPLKTDDFIALLSELERRRQHGLRLAVGLVGLYGLRPAELAVLSFEDGQLRVGQVKRNM
FT                   AAIRKGAKQQARENLRLALPLDLPGHEGLGAQLALQWQSGLVKLPLPIRTAIKTAEKTG
FT                   SYKPVGDAFRQLLDRHRFWKSLVAGNPGLTPYSLRHSFAWRAHKQYDRPLSVRDAAALM
FT                   GHDPETHYKHYGRWTDEAGLLDAVSRLTAQPAKPASQAFGAIGA"
     MRPSVWEPST LCLMVSAESW GKALRRDIKN EYGPGWSVSA QSGKTKLTRR YADGTRSSVM        60
     IEIPFSSGHK RELLIAIGTH AEQMAEQQIS LKESRKRTAV TAANPEGVFV WDEAAKAFYE       120
     TRKDLGPVTQ RNTVTRIEKA LDSLNRKPRP KDGLELLAAF ERQHLQHLQP GSEGRKKSIQ       180
     EVGKFLRFCV ERRGLAGRWM PPVGEQRQEL VGAAEGRDAK LTPPLKTDDF IALLSELERR       240
     RQHGLRLAVG LVGLYGLRPA ELAVLSFEDG QLRVGQVKRN MAAIRKGAKQ QARENLRLAL       300
     PLDLPGHEGL GAQLALQWQS GLVKLPLPIR TAIKTAEKTG SYKPVGDAFR QLLDRHRFWK       360
     SLVAGNPGLT PYSLRHSFAW RAHKQYDRPL SVRDAAALMG HDPETHYKHY GRWTDEAGLL       420
     DAVSRLTAQP AKPASQAFGA IGA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page