(data stored in ACNUC29543 zone)

EMBL: CT978603.PE698

CT978603.PE698       Location/Qualifiers
FT   CDS             complement(630735..631052)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0698"
FT                   /locus_tag="SynRCC307_0698"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27601"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU2"
FT                   /protein_id="CAK27601.1"
FT                   /translation="MVGHRIEGEAVFVHVSAMAKKQNRFANRAGQTRRINGRHVHAKKD
FT                   ENLRIAFAVIEKALRDHPDADLEWFEKVCGDCEGLEDVLKLVRAGALNNFRTNDQMASH
FT                   T"
     MVGHRIEGEA VFVHVSAMAK KQNRFANRAG QTRRINGRHV HAKKDENLRI AFAVIEKALR        60
     DHPDADLEWF EKVCGDCEGL EDVLKLVRAG ALNNFRTNDQ MASHT                       105
//

If you have problems or comments...

PBIL Back to PBIL home page