(data stored in ACNUC29543 zone)

EMBL: CT978603.PE705

CT978603.PE705       Location/Qualifiers
FT   CDS             637697..638041
FT                   /transl_table=11
FT                   /gene="SynRCC307_0705"
FT                   /locus_tag="SynRCC307_0705"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27608"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU9"
FT                   /protein_id="CAK27608.1"
FT                   /translation="MLWAPLQPLAMPLTAAELLSILRERWGASYDLQLHRRAGRLYLQV
FT                   MWAYLEQQSFPLSEEDYLLRLQQLVEQLNGIGQAEAVRNWLQTTRDKPRLGKALSFPLP
FT                   DQGRLSEFLL"
     MLWAPLQPLA MPLTAAELLS ILRERWGASY DLQLHRRAGR LYLQVMWAYL EQQSFPLSEE        60
     DYLLRLQQLV EQLNGIGQAE AVRNWLQTTR DKPRLGKALS FPLPDQGRLS EFLL             114
//

If you have problems or comments...

PBIL Back to PBIL home page