(data stored in ACNUC29543 zone)

EMBL: CT978603.PE713

CT978603.PE713       Location/Qualifiers
FT   CDS             complement(643091..644296)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="SynRCC307_0713"
FT                   /product="Twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27616"
FT                   /db_xref="GOA:A5GRV7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV7"
FT                   /protein_id="CAK27616.1"
FT                   /translation="MRVGPTGFGNPANFKDPKPVCPCQAAGICTCGMSDLPPLPPPPQA
FT                   SSAAPETLAEIVELARRQNYSDIHLGVGEQPRFRERGEIISSGWPVTEAVQFDRWLSEV
FT                   LSSAERERFRSEHDFDGSFAFERVRVRINLMESLRGPAMVLRLIPQTILSLEELQLPEV
FT                   LKTLANRPKGLVLVTGPTGSGKSTTLAAMVDWINRNKPAHILTIEDPIEFVHTSRKALV
FT                   RQREVGHHTLRFKAALRAALREDPDVILIGEIRDGETLTTALEAAQTGHLVFGTLHTNS
FT                   AVRTVERVLGMVPPADQASLRRSLSESLLGVIAQGLIRTTTGGRRAYHDILINTEACRD
FT                   YIERGELDSVEQIMERSGFDGMQTSNQALLHLVQAGEIEGDAALAVSLKSSELAQALRG
FT                   RQ"
     MRVGPTGFGN PANFKDPKPV CPCQAAGICT CGMSDLPPLP PPPQASSAAP ETLAEIVELA        60
     RRQNYSDIHL GVGEQPRFRE RGEIISSGWP VTEAVQFDRW LSEVLSSAER ERFRSEHDFD       120
     GSFAFERVRV RINLMESLRG PAMVLRLIPQ TILSLEELQL PEVLKTLANR PKGLVLVTGP       180
     TGSGKSTTLA AMVDWINRNK PAHILTIEDP IEFVHTSRKA LVRQREVGHH TLRFKAALRA       240
     ALREDPDVIL IGEIRDGETL TTALEAAQTG HLVFGTLHTN SAVRTVERVL GMVPPADQAS       300
     LRRSLSESLL GVIAQGLIRT TTGGRRAYHD ILINTEACRD YIERGELDSV EQIMERSGFD       360
     GMQTSNQALL HLVQAGEIEG DAALAVSLKS SELAQALRGR Q                           401
//

If you have problems or comments...

PBIL Back to PBIL home page