(data stored in ACNUC29543 zone)

EMBL: CT978603.PE721

CT978603.PE721       Location/Qualifiers
FT   CDS             complement(651723..653324)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0721"
FT                   /locus_tag="SynRCC307_0721"
FT                   /product="ABC-type oligopeptide transport system
FT                   periplasmic component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27624"
FT                   /db_xref="GOA:A5GRW5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW5"
FT                   /protein_id="CAK27624.1"
FT                   /translation="MLLARANLKQRGKRAAGLLLASLMLLAGCRPPTASDRAPLVIAAY
FT                   GSIDSVDPAQATTVIALQLISALGDPLYAIDGQGAIQPKLARALPRLSDDGLTATIPLR
FT                   QGVLFHDGTPFDADAMAFSLRRFLAIGKLSYVVGDRISAVRVTGPYELQLDLRRPFSPL
FT                   AKLLSFASLTPISPTAYANYEAGFRPNAFVGTGPYELRLQSPQLQRLEPFAQYWGEAPR
FT                   NDGIALVGMSTSTSLYGAISSGNVDVLLSTSLEPEQQSALHQQANQGQLREGAGPALGI
FT                   GYITLLTDRPPLDNQTLRRALAFSLDRELLTKRVTDKLRPPLRGLVPPKLPGALAAWPR
FT                   ADASRARQLLQQEGYCSGEVLPLQLTYRSNVPTDRLLALSWQEWLRSRLGDCVRLDLTG
FT                   MESTTAYRQLGDGAFQMILLDWMGDYPDADNYLTPLLGCTQSEGNRCLEGDSASGGSFW
FT                   TAPGLEEKLRLSNERRGQARLDLLDAVQREAANGVPYLPMWQTRPRAWARNSITAPQFD
FT                   GSGRLNFASLSRRSLP"
     MLLARANLKQ RGKRAAGLLL ASLMLLAGCR PPTASDRAPL VIAAYGSIDS VDPAQATTVI        60
     ALQLISALGD PLYAIDGQGA IQPKLARALP RLSDDGLTAT IPLRQGVLFH DGTPFDADAM       120
     AFSLRRFLAI GKLSYVVGDR ISAVRVTGPY ELQLDLRRPF SPLAKLLSFA SLTPISPTAY       180
     ANYEAGFRPN AFVGTGPYEL RLQSPQLQRL EPFAQYWGEA PRNDGIALVG MSTSTSLYGA       240
     ISSGNVDVLL STSLEPEQQS ALHQQANQGQ LREGAGPALG IGYITLLTDR PPLDNQTLRR       300
     ALAFSLDREL LTKRVTDKLR PPLRGLVPPK LPGALAAWPR ADASRARQLL QQEGYCSGEV       360
     LPLQLTYRSN VPTDRLLALS WQEWLRSRLG DCVRLDLTGM ESTTAYRQLG DGAFQMILLD       420
     WMGDYPDADN YLTPLLGCTQ SEGNRCLEGD SASGGSFWTA PGLEEKLRLS NERRGQARLD       480
     LLDAVQREAA NGVPYLPMWQ TRPRAWARNS ITAPQFDGSG RLNFASLSRR SLP              533
//

If you have problems or comments...

PBIL Back to PBIL home page