(data stored in ACNUC29543 zone)

EMBL: CT978603.PE726

CT978603.PE726       Location/Qualifiers
FT   CDS             complement(655878..656105)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0726"
FT                   /locus_tag="SynRCC307_0726"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27629"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRX0"
FT                   /protein_id="CAK27629.1"
FT                   /translation="MGRIVKQGFASRCQRVFFDRMIPSLLQSVSTTPSARTQPAKTLQR
FT                   GERPQQALELMIGSLVGMVQAGRTDQVSSR"
     MGRIVKQGFA SRCQRVFFDR MIPSLLQSVS TTPSARTQPA KTLQRGERPQ QALELMIGSL        60
     VGMVQAGRTD QVSSR                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page