(data stored in ACNUC29543 zone)

EMBL: CT978603.PE88

CT978603.PE88        Location/Qualifiers
FT   CDS             complement(87193..88293)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0088"
FT                   /locus_tag="SynRCC307_0088"
FT                   /product="cyanobacteria-specific GntR-like HTH domain
FT                   containing transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26991"
FT                   /db_xref="GOA:A5GQ32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ32"
FT                   /protein_id="CAK26991.1"
FT                   /translation="MAKPTQRTRQELSRGTCATTVARSICCHTPGVRFHIQQESDIPAS
FT                   TQLYNQICFAIAARHFPPGHRLPSTRQLAMQTGLHRNTISKVYRQLENDGVVEAMAGSG
FT                   IYVRDQQKPREVKAPSGPRHRIRPDIDQEVRRSIDGLLNAGCTLQQARELLTREIDWRL
FT                   RCGARVLVSTPREDLGASLLIAEELTPKLEVPVEVVPLEELEAVLESSNNGTVVTSRYF
FT                   LQPVEELAKQHGVRAVAVDLNDFRHELAMLKELRAGSCVGLVSISPGILRAAEVILHSM
FT                   RGQELLVMTASPDVGSRLLALCRAASHVLCDRPSLPLVEQTLRQNRSQLMRLPQVHCAQ
FT                   SYLGASTIDMLCKEIGLDSSANAPSP"
     MAKPTQRTRQ ELSRGTCATT VARSICCHTP GVRFHIQQES DIPASTQLYN QICFAIAARH        60
     FPPGHRLPST RQLAMQTGLH RNTISKVYRQ LENDGVVEAM AGSGIYVRDQ QKPREVKAPS       120
     GPRHRIRPDI DQEVRRSIDG LLNAGCTLQQ ARELLTREID WRLRCGARVL VSTPREDLGA       180
     SLLIAEELTP KLEVPVEVVP LEELEAVLES SNNGTVVTSR YFLQPVEELA KQHGVRAVAV       240
     DLNDFRHELA MLKELRAGSC VGLVSISPGI LRAAEVILHS MRGQELLVMT ASPDVGSRLL       300
     ALCRAASHVL CDRPSLPLVE QTLRQNRSQL MRLPQVHCAQ SYLGASTIDM LCKEIGLDSS       360
     ANAPSP                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page