(data stored in ACNUC29543 zone)

EMBL: CT978603.PE9

CT978603.PE9         Location/Qualifiers
FT   CDS             11034..11777
FT                   /transl_table=11
FT                   /gene="SynRCC307_0009"
FT                   /locus_tag="SynRCC307_0009"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26912"
FT                   /db_xref="GOA:A5GPV3"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV3"
FT                   /protein_id="CAK26912.1"
FT                   /translation="MVQSRSRSEPPVNVRLQQDLKNDLIAGLLVVIPLATTIWLATLVT
FT                   RFVVSFLTSVPKQFNPFNTLNPLLQELINLSVGLLVPLLGILLIGLMARNIVGRWLLDF
FT                   GEGTLARIPLAGSVYKTLKQILETVLRDNSTRFRRVVLIEYPRDGIYALGFVTGMLSAG
FT                   MQAGFPQPMISVFIPTAPNPTTGWYSIVPEASVKDLDMSVEEAFRTIISAGIVNPDEQP
FT                   SPSNRSFSSLLAQLRPTPLSAPPKA"
     MVQSRSRSEP PVNVRLQQDL KNDLIAGLLV VIPLATTIWL ATLVTRFVVS FLTSVPKQFN        60
     PFNTLNPLLQ ELINLSVGLL VPLLGILLIG LMARNIVGRW LLDFGEGTLA RIPLAGSVYK       120
     TLKQILETVL RDNSTRFRRV VLIEYPRDGI YALGFVTGML SAGMQAGFPQ PMISVFIPTA       180
     PNPTTGWYSI VPEASVKDLD MSVEEAFRTI ISAGIVNPDE QPSPSNRSFS SLLAQLRPTP       240
     LSAPPKA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page