(data stored in ACNUC29543 zone)

EMBL: CT978603.PE94

CT978603.PE94        Location/Qualifiers
FT   CDS             93020..93442
FT                   /transl_table=11
FT                   /gene="SynRCC307_0094"
FT                   /locus_tag="SynRCC307_0094"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26997"
FT                   /db_xref="GOA:A5GQ38"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ38"
FT                   /protein_id="CAK26997.1"
FT                   /translation="MSEVVAPAPFYWEAILVALGAVPGAWLRLRVVNHFEPVVPHKHWG
FT                   TFFVNVSAAFFLGLFSGLHTLQLKACSGVDGTAPMMLLVGVGFFGSLSTFSTFVVELLN
FT                   TLQSRQFLQFVGLMVFSLVIGLLAAAAGYQLGLSHG"
     MSEVVAPAPF YWEAILVALG AVPGAWLRLR VVNHFEPVVP HKHWGTFFVN VSAAFFLGLF        60
     SGLHTLQLKA CSGVDGTAPM MLLVGVGFFG SLSTFSTFVV ELLNTLQSRQ FLQFVGLMVF       120
     SLVIGLLAAA AGYQLGLSHG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page