(data stored in ACNUC29543 zone)

EMBL: CT978603.PLSX

CT978603.PLSX        Location/Qualifiers
FT   CDS             complement(246844..248061)
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SynRCC307_0249"
FT                   /product="Fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27152"
FT                   /db_xref="GOA:A5GQJ3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ3"
FT                   /protein_id="CAK27152.1"
FT                   /translation="MAEPQSLPGRTRRPRPRRAIKRLVIWYRRTGPVIRLVNTAHSALG
FT                   PLRLGQTRPGGARAVKGPRLSIAVDGMGGDYAPGPILEGCLGAIEELPLKVMFFAEEKP
FT                   LQAAIKALELQEAVDQAVAKGHLELIASGPSVGMDDEATSVRRKRQASINLAMDRVKAG
FT                   EALAVYSAGNSGAVMAAAIFRLGRLKGIERPAIGALFPTKDVGQQVLVLDVGANTDCKP
FT                   SYLHQFALLGNIYARDVLGVKQPRVGLLNIGEEECKGNELALKTHPLLVEEKRLNFAGN
FT                   CEGRDVLSGEFDVVVCDGFTGNVLLKFLESVGSVLLEVLKAELPRGRRGKVGSAFLISN
FT                   LRRIKKRLDHAEHGGALLLGVDGLCVIGHGSSKARSVMGALRLAHAAASHNTLDNLHRL
FT                   SDEGVG"
     MAEPQSLPGR TRRPRPRRAI KRLVIWYRRT GPVIRLVNTA HSALGPLRLG QTRPGGARAV        60
     KGPRLSIAVD GMGGDYAPGP ILEGCLGAIE ELPLKVMFFA EEKPLQAAIK ALELQEAVDQ       120
     AVAKGHLELI ASGPSVGMDD EATSVRRKRQ ASINLAMDRV KAGEALAVYS AGNSGAVMAA       180
     AIFRLGRLKG IERPAIGALF PTKDVGQQVL VLDVGANTDC KPSYLHQFAL LGNIYARDVL       240
     GVKQPRVGLL NIGEEECKGN ELALKTHPLL VEEKRLNFAG NCEGRDVLSG EFDVVVCDGF       300
     TGNVLLKFLE SVGSVLLEVL KAELPRGRRG KVGSAFLISN LRRIKKRLDH AEHGGALLLG       360
     VDGLCVIGHG SSKARSVMGA LRLAHAAASH NTLDNLHRLS DEGVG                       405
//

If you have problems or comments...

PBIL Back to PBIL home page