(data stored in ACNUC29543 zone)

EMBL: CT978603.PNTAA

CT978603.PNTAA       Location/Qualifiers
FT   CDS             complement(346077..347231)
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="SynRCC307_0360"
FT                   /product="NAD/NADP transhydrogenase subunit alpha part 1"
FT                   /EC_number="1.6.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27263"
FT                   /db_xref="GOA:A5GQV4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV4"
FT                   /protein_id="CAK27263.1"
FT                   /translation="MVKVLIPREWDAGETRVASSPEVVKRLAGRHVQCSVERGAGRQAG
FT                   FSDEDYAAAGADLVNPGDRATWSQSDIILSVGPLGDNTAALKPGAVVIGQLAPHNNNAL
FT                   LDQLEKGQLSAISLELLPRISRAQAMDVLSSQANIAGYKAVLLAAADLDRFMPMLMTAA
FT                   GTVQPAKVVVIGAGVAGLQAVATARRLGAVVSVSDVRAAAQEQVESLGARFIPPPEQGV
FT                   PGESGGYAKQATMSFLDAQRAGLSEHLNQADVVICTAQVPGRPAPMLITSAMVSAMRPG
FT                   AVIVDLAVIQGGNCELSQAGQTVEHHGVKVIGADRLPGSVAHHASSLYARNLMSLLEAL
FT                   IDQEGVLKLDSEDELLAPSLISLDGNLRRTDLVPERATSSEMTP"
     MVKVLIPREW DAGETRVASS PEVVKRLAGR HVQCSVERGA GRQAGFSDED YAAAGADLVN        60
     PGDRATWSQS DIILSVGPLG DNTAALKPGA VVIGQLAPHN NNALLDQLEK GQLSAISLEL       120
     LPRISRAQAM DVLSSQANIA GYKAVLLAAA DLDRFMPMLM TAAGTVQPAK VVVIGAGVAG       180
     LQAVATARRL GAVVSVSDVR AAAQEQVESL GARFIPPPEQ GVPGESGGYA KQATMSFLDA       240
     QRAGLSEHLN QADVVICTAQ VPGRPAPMLI TSAMVSAMRP GAVIVDLAVI QGGNCELSQA       300
     GQTVEHHGVK VIGADRLPGS VAHHASSLYA RNLMSLLEAL IDQEGVLKLD SEDELLAPSL       360
     ISLDGNLRRT DLVPERATSS EMTP                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page