(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBD

CT978603.PSBD        Location/Qualifiers
FT   CDS             256888..257946
FT                   /transl_table=11
FT                   /gene="psbD"
FT                   /locus_tag="SynRCC307_0259"
FT                   /product="Photosystem II D2 protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27162"
FT                   /db_xref="GOA:A5GQK3"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005868"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK3"
FT                   /protein_id="CAK27162.1"
FT                   /translation="MTIAVGRAPAGRGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYMAL
FT                   GGWLTGTTFVTSWYTHGIASSYLEGCNFLTAAVSTPADSMGHSLLLLWGPEAQGDFVRW
FT                   CQLGGLWAFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLG
FT                   QSSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTL
FT                   FEDGDGANTFKAFEPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWT
FT                   SSIGIIGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFI
FT                   FPEEVLPRGNAL"
     MTIAVGRAPA GRGWFDVLDD WLKRDRFVFV GWSGLLLFPC AYMALGGWLT GTTFVTSWYT        60
     HGIASSYLEG CNFLTAAVST PADSMGHSLL LLWGPEAQGD FVRWCQLGGL WAFVALHGAF       120
     GLIGFMLRQF EIARLVGIRP YNAIAFSGPI AVFVSVFLMY PLGQSSWFFA PSFGVAAIFR       180
     FLLFLQGFHN WTLNPFHMMG VAGILGGALL CAIHGATVEN TLFEDGDGAN TFKAFEPTQE       240
     EETYSMVTAN RFWSQIFGIA FSNKRWLHFF MLFVPVMGLW TSSIGIIGLA LNLRAYDFVS       300
     QELRAAEDPE FETFYTKNIL LNEGLRAWMA PADQPHENFI FPEEVLPRGN AL               352
//

If you have problems or comments...

PBIL Back to PBIL home page