(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBF

CT978603.PSBF        Location/Qualifiers
FT   CDS             complement(210856..210993)
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="SynRCC307_0209"
FT                   /product="Cytochrome b559 beta subunit (PSII reaction
FT                   center subunit VI)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27112"
FT                   /db_xref="GOA:A5GQF3"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQF3"
FT                   /protein_id="CAK27112.1"
FT                   /translation="MTSTPSPATPRNYPIFTVRWLSLHALGIPTVFFLGALAAMQFVRR
FT                   "
     MTSTPSPATP RNYPIFTVRW LSLHALGIPT VFFLGALAAM QFVRR                        45
//

If you have problems or comments...

PBIL Back to PBIL home page